top
  menu  

Help

Input Sequence

Paste your AMINO ACID sequences here. Sequences must follow the FASTA format. The length of protein must be larger than 30.
Sequence format is shown in the following example.

>MCA3_MOUSE
MAAAAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLVKQASKEHLLGSTAEEKAMVQQWLEFRVTRVDGHSSKEDTQTLLKDLNSYL
EDKVYLAGHNITLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPDIRQHLSSIVFIKNRLYANSH
>ACT1_ABSGL
MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
HPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Output format

The prediction result is a html file showing the prediction score and the template protein we used. MLCS is the multi-localized confidence score which is designed to give a relative measure of the likelihood that the query sequence is multi-localized into two organelles. We also show the sequence identities of the first 10 template proteins with the query protein.




footer
Home IASL Hsu Sung contact